Lineage for d3bdha_ (3bdh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138455Family c.76.1.1: Alkaline phosphatase [53650] (2 protein domains)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2138456Protein Alkaline phosphatase [53651] (4 species)
  7. 2138464Species Escherichia coli [TaxId:562] [53652] (44 PDB entries)
  8. 2138471Domain d3bdha_: 3bdh A: [172562]
    automated match to d1ajaa_
    complexed with mg

Details for d3bdha_

PDB Entry: 3bdh (more details), 1.85 Å

PDB Description: Crystal structure of zinc-deficient wild-type E. coli alkaline phosphatase
PDB Compounds: (A:) alkaline phosphatase

SCOPe Domain Sequences for d3bdha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdha_ c.76.1.1 (A:) Alkaline phosphatase {Escherichia coli [TaxId: 562]}
tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
aygphaanvvgltdqtdlfytmkaalglk

SCOPe Domain Coordinates for d3bdha_:

Click to download the PDB-style file with coordinates for d3bdha_.
(The format of our PDB-style files is described here.)

Timeline for d3bdha_: