Lineage for d3bdgb_ (3bdg B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138455Family c.76.1.1: Alkaline phosphatase [53650] (2 protein domains)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2138456Protein Alkaline phosphatase [53651] (4 species)
  7. 2138464Species Escherichia coli [TaxId:562] [53652] (44 PDB entries)
  8. 2138466Domain d3bdgb_: 3bdg B: [172561]
    automated match to d1ajaa_
    complexed with so4

Details for d3bdgb_

PDB Entry: 3bdg (more details), 1.4 Å

PDB Description: Crystal structure of wild-type/T155V mixed dimer of E. coli alkaline phosphatase
PDB Compounds: (B:) alkaline phosphatase

SCOPe Domain Sequences for d3bdgb_:

Sequence, based on SEQRES records: (download)

>d3bdgb_ c.76.1.1 (B:) Alkaline phosphatase {Escherichia coli [TaxId: 562]}
mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarn
yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
ihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnal
ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
dkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntl
vivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaayg
phaanvvgltdqtdlfytmkaalglk

Sequence, based on observed residues (ATOM records): (download)

>d3bdgb_ c.76.1.1 (B:) Alkaline phosphatase {Escherichia coli [TaxId: 562]}
mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarn
yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
ihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnal
ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
dkaiellsknekgfflqvegasiaanpcgqigetvdldeavqralefakkegntlvivta
dhahasqivapdtkapgltqalntkdgavmvmsyghtgsqlriaaygphaanvvgltdqt
dlfytmkaalglk

SCOPe Domain Coordinates for d3bdgb_:

Click to download the PDB-style file with coordinates for d3bdgb_.
(The format of our PDB-style files is described here.)

Timeline for d3bdgb_: