Lineage for d2scpa_ (2scp A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3288Family a.39.1.5: Calmodulin-like [47502] (13 proteins)
  6. 3396Protein Sarcoplasmic calcium-binding protein [47509] (2 species)
  7. 3399Species Sandworm (Nereis diversicolor) [TaxId:126592] [47510] (1 PDB entry)
  8. 3400Domain d2scpa_: 2scp A: [17256]

Details for d2scpa_

PDB Entry: 2scp (more details), 2 Å

PDB Description: structure of a sarcoplasmic calcium-binding protein from nereis diversicolor refined at 2.0 angstroms resolution

SCOP Domain Sequences for d2scpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor)}
sdlwvqkmktyfnridfdkdgaitrmdfesmaerfakesemkaehakvlmdsltgvwdnf
ltavaggkgidettfinsmkemvknpeaksvvegplplffravdtnednnisrdeygiff
gmlgldktmapasfdaidtnndgllsleefviagsdffmndgdstnkvfwgplv

SCOP Domain Coordinates for d2scpa_:

Click to download the PDB-style file with coordinates for d2scpa_.
(The format of our PDB-style files is described here.)

Timeline for d2scpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2scpb_