Lineage for d1mxlc_ (1mxl C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3288Family a.39.1.5: Calmodulin-like [47502] (13 proteins)
  6. 3402Protein Troponin C [47503] (5 species)
  7. 3430Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (3 PDB entries)
  8. 3433Domain d1mxlc_: 1mxl C: [17255]
    Other proteins in same PDB: d1mxli_

Details for d1mxlc_

PDB Entry: 1mxl (more details)

PDB Description: structure of cardiac troponin c-troponin i complex

SCOP Domain Sequences for d1mxlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mxlc_ a.39.1.5 (C:) Troponin C {Human (Homo sapiens), cardiac isoform}
mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrcmkdds

SCOP Domain Coordinates for d1mxlc_:

Click to download the PDB-style file with coordinates for d1mxlc_.
(The format of our PDB-style files is described here.)

Timeline for d1mxlc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mxli_