Lineage for d3bcqd_ (3bcq D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903633Species Brycon cephalus [TaxId:126311] [188621] (1 PDB entry)
  8. 903637Domain d3bcqd_: 3bcq D: [172549]
    automated match to d1spgb_
    complexed with hem, oxy

Details for d3bcqd_

PDB Entry: 3bcq (more details), 2.4 Å

PDB Description: crystal structure of oxy-hemoglobin from brycon cephalus
PDB Compounds: (D:) Beta-chain hemoglobin

SCOPe Domain Sequences for d3bcqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bcqd_ a.1.1.2 (D:) automated matches {Brycon cephalus [TaxId: 126311]}
vewstaersaiaglwgkisvdeigpqalsrllivypwtqrhfaafgnlsspaaingnpkv
ahhgkvvmggleraiknmdnikaaysslsvmhseklhvdpdnfrlladcitvcvamkfgp
saftpdvqeawqkflavvvaalsryh

SCOPe Domain Coordinates for d3bcqd_:

Click to download the PDB-style file with coordinates for d3bcqd_.
(The format of our PDB-style files is described here.)

Timeline for d3bcqd_: