Lineage for d3bcqc_ (3bcq C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903633Species Brycon cephalus [TaxId:126311] [188621] (1 PDB entry)
  8. 903636Domain d3bcqc_: 3bcq C: [172548]
    automated match to d1xq5a_
    complexed with hem, oxy

Details for d3bcqc_

PDB Entry: 3bcq (more details), 2.4 Å

PDB Description: crystal structure of oxy-hemoglobin from brycon cephalus
PDB Compounds: (C:) Alpha-chain hemoglobin

SCOPe Domain Sequences for d3bcqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bcqc_ a.1.1.2 (C:) automated matches {Brycon cephalus [TaxId: 126311]}
slsdkdkdsikafwakispkaedigadalarmltvypqtktyfshwkdlspgsapvkkhg
ktvmgsvaeavskiddltnglltlselhafqlrvdpanfkilshnllvvlaqqfpndftp
evhvsmdkflsllswslsekyr

SCOPe Domain Coordinates for d3bcqc_:

Click to download the PDB-style file with coordinates for d3bcqc_.
(The format of our PDB-style files is described here.)

Timeline for d3bcqc_: