Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (30 species) not a true protein |
Species Brycon cephalus [TaxId:126311] [188621] (1 PDB entry) |
Domain d3bcqc_: 3bcq C: [172548] automated match to d1xq5a_ complexed with hem, oxy |
PDB Entry: 3bcq (more details), 2.4 Å
SCOPe Domain Sequences for d3bcqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bcqc_ a.1.1.2 (C:) automated matches {Brycon cephalus [TaxId: 126311]} slsdkdkdsikafwakispkaedigadalarmltvypqtktyfshwkdlspgsapvkkhg ktvmgsvaeavskiddltnglltlselhafqlrvdpanfkilshnllvvlaqqfpndftp evhvsmdkflsllswslsekyr
Timeline for d3bcqc_: