SCOPe 2.08: Domain d1spya_: 1spy A:

Lineage for d1spya_ (1spy A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries)

8. Domain d1spya_: 1spy A: [17254]
   N-domain only
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1spya_

PDB Entry: 1spy

PDB Description: regulatory domain of human cardiac troponin c in the calcium-free state, nmr, 40 structures

PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d1spya_:

Sequence; same for both SEQRES and ATOM records:

>d1spya_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrcmkdds

Timeline for d1spya_:

• d1spya_ first appeared (with stable ids) in SCOP 1.55, called d1spy__
  
• d1spya_ appears in SCOPe 2.07