Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein automated matches [190264] (8 species) not a true protein |
Species Tabernaemontana divaricata [TaxId:52861] [187993] (3 PDB entries) |
Domain d3bcna_: 3bcn A: [172538] automated match to d1o0ea_ complexed with bme, e64 |
PDB Entry: 3bcn (more details), 2.85 Å
SCOPe Domain Sequences for d3bcna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bcna_ d.3.1.1 (A:) automated matches {Tabernaemontana divaricata [TaxId: 52861]} lpehvdwrakgaviplknqgkcgscwafstvttvesinqirtgnlislseqqlvdcskkn hgckggyfdrayqyiianggidteanypykafqgpcraakkvvridgckgvpqcnenalk navasqpsvvaidasskqfqhykggiftgpcgtklnhgvvivgygkdywivrnswgrhwg eqgytrmkrvggcglcgiarlpfyptkax
Timeline for d3bcna_: