Lineage for d3bcmb_ (3bcm B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928455Protein Seminal ribonucleasease [54086] (1 species)
  7. 2928456Species Cow (Bos taurus) [TaxId:9913] [54087] (17 PDB entries)
    Uniprot P00669 27-150
  8. 2928468Domain d3bcmb_: 3bcm B: [172537]
    automated match to d1y94a_
    complexed with po4

Details for d3bcmb_

PDB Entry: 3bcm (more details), 2.25 Å

PDB Description: crystal structure of the unswapped form of p19a/l28q/n67d bs-rnase
PDB Compounds: (B:) Seminal ribonuclease

SCOPe Domain Sequences for d3bcmb_:

Sequence, based on SEQRES records: (download)

>d3bcmb_ d.5.1.1 (B:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnsassssnycnqmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

Sequence, based on observed residues (ATOM records): (download)

>d3bcmb_ d.5.1.1 (B:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgssnycnqmmccrkmtqgkckpvntfvhesladvkavcsqkkvtc
kdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhfdasv

SCOPe Domain Coordinates for d3bcmb_:

Click to download the PDB-style file with coordinates for d3bcmb_.
(The format of our PDB-style files is described here.)

Timeline for d3bcmb_: