Lineage for d1ap4__ (1ap4 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3288Family a.39.1.5: Calmodulin-like [47502] (13 proteins)
  6. 3402Protein Troponin C [47503] (5 species)
  7. 3430Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (3 PDB entries)
  8. 3431Domain d1ap4__: 1ap4 - [17253]

Details for d1ap4__

PDB Entry: 1ap4 (more details)

PDB Description: regulatory domain of human cardiac troponin c in the calcium-saturated state, nmr, 40 structures

SCOP Domain Sequences for d1ap4__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap4__ a.39.1.5 (-) Troponin C {Human (Homo sapiens), cardiac isoform}
mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrcmkdds

SCOP Domain Coordinates for d1ap4__:

Click to download the PDB-style file with coordinates for d1ap4__.
(The format of our PDB-style files is described here.)

Timeline for d1ap4__: