Lineage for d3bb1d_ (3bb1 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2111131Protein automated matches [190047] (28 species)
    not a true protein
  7. 2111494Species Pea (Pisum sativum) [TaxId:3888] [188398] (1 PDB entry)
  8. 2111498Domain d3bb1d_: 3bb1 D: [172526]
    automated match to d1h65b_
    complexed with gnp, gol, mg, pge

Details for d3bb1d_

PDB Entry: 3bb1 (more details), 2.8 Å

PDB Description: Crystal structure of Toc34 from Pisum sativum in complex with Mg2+ and GMPPNP
PDB Compounds: (D:) Translocase of chloroplast 34

SCOPe Domain Sequences for d3bb1d_:

Sequence, based on SEQRES records: (download)

>d3bb1d_ c.37.1.8 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
tvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvs
ispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyv
drldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseall
qvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnk
sesifvdknlid

Sequence, based on observed residues (ATOM records): (download)

>d3bb1d_ c.37.1.8 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
tvrgwsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvs
ispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyv
drldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseall
qvvrsgaslkkdaasdipvvliensgrcndekvlpngiawiphlvqtitevalnksesif
vdknlid

SCOPe Domain Coordinates for d3bb1d_:

Click to download the PDB-style file with coordinates for d3bb1d_.
(The format of our PDB-style files is described here.)

Timeline for d3bb1d_: