Lineage for d1fi5a_ (1fi5 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47621Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 47751Protein Troponin C [47503] (5 species)
  7. 47778Species Chicken (Gallus gallus), cardiac isoform [TaxId:9031] [47507] (1 PDB entry)
  8. 47779Domain d1fi5a_: 1fi5 A: [17252]

Details for d1fi5a_

PDB Entry: 1fi5 (more details)

PDB Description: nmr structure of the c terminal domain of cardiac troponin c bound to the n terminal domain of cardiac troponin i.

SCOP Domain Sequences for d1fi5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform}
mvrcmkddskgkteeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdg
dknndgridydeflefmkgve

SCOP Domain Coordinates for d1fi5a_:

Click to download the PDB-style file with coordinates for d1fi5a_.
(The format of our PDB-style files is described here.)

Timeline for d1fi5a_: