Lineage for d3bafa_ (3baf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866357Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
    automatically mapped to Pfam PF01202
  6. 2866358Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 2866372Species Mycobacterium tuberculosis [TaxId:1773] [75194] (11 PDB entries)
    Uniprot P95014
  8. 2866385Domain d3bafa_: 3baf A: [172518]
    automated match to d1l4ua_
    complexed with anp, skm

Details for d3bafa_

PDB Entry: 3baf (more details), 2.25 Å

PDB Description: crystal structure of shikimate kinase from mycobacterium tuberculosis in complex with amp-pnp
PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d3bafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bafa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrl

SCOPe Domain Coordinates for d3bafa_:

Click to download the PDB-style file with coordinates for d3bafa_.
(The format of our PDB-style files is described here.)

Timeline for d3bafa_: