| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (5 families) ![]() has a circularly permuted topology |
| Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins) automatically mapped to Pfam PF01653 |
| Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (4 species) contains additional, N-terminal all-alpha subdomain |
| Species Enterococcus faecalis [TaxId:1351] [118124] (8 PDB entries) Uniprot Q837V6 5-317 |
| Domain d3baba_: 3bab A: [172517] automated match to d1taea_ complexed with 3bd, gol, nmn, so4 |
PDB Entry: 3bab (more details), 2.5 Å
SCOPe Domain Sequences for d3baba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3baba_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Enterococcus faecalis [TaxId: 1351]}
ltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdlitpdsp
tqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelkidgla
islryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympkqsfva
lneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktqfeale
elsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqdelgftv
kaprwaiaykfp
Timeline for d3baba_: