Lineage for d3b9ke_ (3b9k E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739659Protein CD8 [48734] (3 species)
  7. 2739668Species Mouse (Mus musculus) [TaxId:10090] [48736] (5 PDB entries)
  8. 2739674Domain d3b9ke_: 3b9k E: [172510]
    Other proteins in same PDB: d3b9kc1, d3b9kc2, d3b9kd_, d3b9kh_, d3b9kl1, d3b9kl2
    automated match to d1bqhh_
    complexed with nag

Details for d3b9ke_

PDB Entry: 3b9k (more details), 2.7 Å

PDB Description: crystal structure of cd8alpha-beta in complex with yts 156.7 fab
PDB Compounds: (E:) T-cell surface glycoprotein CD8 alpha chain

SCOPe Domain Sequences for d3b9ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9ke_ b.1.1.1 (E:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqk

SCOPe Domain Coordinates for d3b9ke_:

Click to download the PDB-style file with coordinates for d3b9ke_.
(The format of our PDB-style files is described here.)

Timeline for d3b9ke_: