![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Troponin C [47503] (6 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47506] (4 PDB entries) |
![]() | Domain d1a2xa_: 1a2x A: [17251] Other proteins in same PDB: d1a2xb_ complexed with a 47 residue (1-47) fragment of troponin I complexed with ca |
PDB Entry: 1a2x (more details), 2.3 Å
SCOPe Domain Sequences for d1a2xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2xa_ a.39.1.5 (A:) Troponin C {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} dqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiiee vdedgsgtidfeeflvmmvrqmkedakgkseeelaecfrifdrnadgyidaeelaeifra sgehvtdeeieslmkdgdknndgridfdeflkmmegvq
Timeline for d1a2xa_: