Lineage for d1a2xa_ (1a2x A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47621Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 47751Protein Troponin C [47503] (5 species)
  7. 47784Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47506] (4 PDB entries)
  8. 47788Domain d1a2xa_: 1a2x A: [17251]
    Other proteins in same PDB: d1a2xb_

Details for d1a2xa_

PDB Entry: 1a2x (more details), 2.3 Å

PDB Description: complex of troponin c with a 47 residue (1-47) fragment of troponin i

SCOP Domain Sequences for d1a2xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2xa_ a.39.1.5 (A:) Troponin C {Rabbit (Oryctolagus cuniculus)}
dqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiiee
vdedgsgtidfeeflvmmvrqmkedakgkseeelaecfrifdrnadgyidaeelaeifra
sgehvtdeeieslmkdgdknndgridfdeflkmmegvq

SCOP Domain Coordinates for d1a2xa_:

Click to download the PDB-style file with coordinates for d1a2xa_.
(The format of our PDB-style files is described here.)

Timeline for d1a2xa_: