Lineage for d3b9ha_ (3b9h A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212113Protein Thymidylate synthase [55833] (7 species)
  7. 2212128Species Escherichia coli [TaxId:562] [55834] (67 PDB entries)
  8. 2212222Domain d3b9ha_: 3b9h A: [172508]
    automated match to d1aiqa_
    protein/RNA complex; complexed with ndu, po4

Details for d3b9ha_

PDB Entry: 3b9h (more details), 2.49 Å

PDB Description: e. coli thymidylate synthase complexed with 5-nitro-2'-deoxy uridine
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d3b9ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9ha_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d3b9ha_:

Click to download the PDB-style file with coordinates for d3b9ha_.
(The format of our PDB-style files is described here.)

Timeline for d3b9ha_: