SCOPe 2.03: Domain d3b9cd_: 3b9c D:

Lineage for d3b9cd_ (3b9c D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (29 PDB entries)

8. Domain d3b9cd_: 3b9c D: [172505]
   automated match to d1bkza_
   complexed with bme, so4

Details for d3b9cd_

PDB Entry: 3b9c, 1.9 Å

PDB Description: Crystal Structure of Human GRP CRD

PDB Compounds: (D:) hspc159

SCOPe Domain Sequences for d3b9cd_:

Sequence; same for both SEQRES and ATOM records:

>d3b9cd_ b.29.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqllr
nscisgergeeqsaipyfpfipdqpfrveilceyprfrvfvdghqlfdfyhriqtlsaid
tikingdlqitklg

Timeline for d3b9cd_:

• d3b9cd_ first appeared in SCOPe 2.01
  
• d3b9cd_ appears in SCOPe 2.02
  
• d3b9cd_ appears in SCOPe 2.04
  
• d3b9cd_ appears in the current release, SCOPe 2.08