Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187655] (25 PDB entries) |
Domain d3b9cb_: 3b9c B: [172503] automated match to d1bkza_ complexed with bme, so4 |
PDB Entry: 3b9c (more details), 1.9 Å
SCOPe Domain Sequences for d3b9cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9cb_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqllr nscisgergeeqsaipyfpfipdqpfrveilceyprfrvfvdghqlfdfyhriqtlsaid tikingdlqitklg
Timeline for d3b9cb_: