Class a: All alpha proteins [46456] (285 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Troponin C [47503] (6 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47506] (4 PDB entries) |
Domain d1tcfa_: 1tcf A: [17250] calcium-saturated form complexed with ca |
PDB Entry: 1tcf (more details), 1.9 Å
SCOPe Domain Sequences for d1tcfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcfa_ a.39.1.5 (A:) Troponin C {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} dqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiiee vdedgsgtidfeeflvmmvrqmkedakgkseeelaelfrifdrnadgyidaeelaeifra sgehvtdeeieslmkdgdknndgridfdeflkmmeg
Timeline for d1tcfa_: