SCOPe 2.04: Domain d1tcfa_: 1tcf A:

Lineage for d1tcfa_ (1tcf A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47506] (4 PDB entries)

8. Domain d1tcfa_: 1tcf A: [17250]
   calcium-saturated form
   complexed with ca

Details for d1tcfa_

PDB Entry: 1tcf, 1.9 Å

PDB Description: crystal structure of calcium-saturated rabbit skeletal troponin c

PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d1tcfa_:

Sequence; same for both SEQRES and ATOM records:

>d1tcfa_ a.39.1.5 (A:) Troponin C {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiiee
vdedgsgtidfeeflvmmvrqmkedakgkseeelaelfrifdrnadgyidaeelaeifra
sgehvtdeeieslmkdgdknndgridfdeflkmmeg

Timeline for d1tcfa_:

• d1tcfa_ first appeared (with stable ids) in SCOP 1.55, called d1tcf__
  
• d1tcfa_ appears in SCOPe 2.03
  
• d1tcfa_ appears in SCOPe 2.05
  
• d1tcfa_ appears in the current release, SCOPe 2.08