Lineage for d1tcf__ (1tcf -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.5: Calmodulin-like [47502] (15 proteins) 
Protein Troponin C [47503] (5 species) 
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47506] (4 PDB entries) 
Domain d1tcf__: 1tcf - [17250]
Details for d1tcf__
PDB Entry: 1tcf (more details), 1.9 Å
PDB Description: crystal structure of calcium-saturated rabbit skeletal troponin c
SCOP Domain Sequences for d1tcf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcf__ a.39.1.5 (-) Troponin C {Rabbit (Oryctolagus cuniculus)}
dqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiiee
vdedgsgtidfeeflvmmvrqmkedakgkseeelaelfrifdrnadgyidaeelaeifra
sgehvtdeeieslmkdgdknndgridfdeflkmmeg
SCOP Domain Coordinates for d1tcf__:
Click to download the PDB-style file with coordinates for d1tcf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tcf__:
- d1tcf__ first appeared (with stable ids) in SCOP 1.55
- d1tcf__ appears in SCOP 1.59
- d1tcf__ appears in the current release, SCOPe 2.08, called d1tcfa_
View in 3D