Lineage for d3b8qb_ (3b8q B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043573Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. 1043574Species Human (Homo sapiens) [TaxId:9606] [56161] (20 PDB entries)
  8. 1043600Domain d3b8qb_: 3b8q B: [172497]
    automated match to d1vr2a_
    complexed with 900

Details for d3b8qb_

PDB Entry: 3b8q (more details), 2.75 Å

PDB Description: crystal structure of the vegfr2 kinase domain in complex with a naphthamide inhibitor
PDB Compounds: (B:) Vascular endothelial growth factor receptor 2

SCOPe Domain Sequences for d3b8qb_:

Sequence, based on SEQRES records: (download)

>d3b8qb_ d.144.1.7 (B:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathseh
ralmselkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrnefvpyk
vapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgl
ardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgv
kideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqa

Sequence, based on observed residues (ATOM records): (download)

>d3b8qb_ d.144.1.7 (B:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrggqvieadafgidktatcrtvavkmlkegathsehra
lmselkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrnefvpykyk
dfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfglplkwmape
tifdrvytiqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdyttpem
yqtmldcwhgepsqrptfselvehlgnllqa

SCOPe Domain Coordinates for d3b8qb_:

Click to download the PDB-style file with coordinates for d3b8qb_.
(The format of our PDB-style files is described here.)

Timeline for d3b8qb_: