Lineage for d3b8hd_ (3b8h D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1225847Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1225848Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1225849Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1225933Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. 1225934Species Pseudomonas aeruginosa [TaxId:287] [56407] (10 PDB entries)
  8. 1225948Domain d3b8hd_: 3b8h D: [172494]
    automated match to d1aera_
    protein/RNA complex; complexed with nad

Details for d3b8hd_

PDB Entry: 3b8h (more details), 2.5 Å

PDB Description: structure of the eef2-exoa(e546a)-nad+ complex
PDB Compounds: (D:) exotoxin a

SCOPe Domain Sequences for d3b8hd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b8hd_ d.166.1.1 (D:) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpaeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d3b8hd_:

Click to download the PDB-style file with coordinates for d3b8hd_.
(The format of our PDB-style files is described here.)

Timeline for d3b8hd_: