SCOPe 2.01: Domain d3b8hd_: 3b8h D:

Lineage for d3b8hd_ (3b8h D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Exotoxin A, C-terminal domain [56406] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [56407] (12 PDB entries)

8. Domain d3b8hd_: 3b8h D: [172494]
   automated match to d1aera_
   protein/RNA complex; complexed with nad

Details for d3b8hd_

PDB Entry: 3b8h, 2.5 Å

PDB Description: structure of the eef2-exoa(e546a)-nad+ complex

PDB Compounds: (D:) exotoxin a

SCOPe Domain Sequences for d3b8hd_:

Sequence; same for both SEQRES and ATOM records:

>d3b8hd_ d.166.1.1 (D:) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpaeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

Timeline for d3b8hd_:

• d3b8hd_ is new in SCOPe 2.01-stable
  
• d3b8hd_ appears in SCOPe 2.02
  
• d3b8hd_ appears in the current release, SCOPe 2.08, called d3b8hd1