Lineage for d3b88b_ (3b88 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2321013Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2321014Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 protein domains)
    automatically mapped to Pfam PF01395
  6. 2321027Protein Odorant binding protein LUSH [101190] (1 species)
  7. 2321028Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)
  8. 2321044Domain d3b88b_: 3b88 B: [172492]
    automated match to d1ooha_
    complexed with act, ete

Details for d3b88b_

PDB Entry: 3b88 (more details), 2 Å

PDB Description: complex of t57a substituted drosophila lush protein with ethanol
PDB Compounds: (B:) General odorant-binding protein lush

SCOPe Domain Sequences for d3b88b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b88b_ a.39.2.1 (B:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagavnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

SCOPe Domain Coordinates for d3b88b_:

Click to download the PDB-style file with coordinates for d3b88b_.
(The format of our PDB-style files is described here.)

Timeline for d3b88b_: