SCOPe 2.05: Domain d3b88a_: 3b88 A:

Lineage for d3b88a_ (3b88 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Odorant binding protein LUSH [101190] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)

8. Domain d3b88a_: 3b88 A: [172491]
   automated match to d1ooha_
   complexed with act, ete

Details for d3b88a_

PDB Entry: 3b88, 2 Å

PDB Description: complex of t57a substituted drosophila lush protein with ethanol

PDB Compounds: (A:) General odorant-binding protein lush

SCOPe Domain Sequences for d3b88a_:

Sequence; same for both SEQRES and ATOM records:

>d3b88a_ a.39.2.1 (A:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagavnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

Timeline for d3b88a_:

• d3b88a_ first appeared in SCOPe 2.01
  
• d3b88a_ appears in SCOPe 2.04
  
• d3b88a_ appears in SCOPe 2.06
  
• d3b88a_ appears in the current release, SCOPe 2.08