| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Troponin C [47503] (6 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47506] (4 PDB entries) |
| Domain d2tn4a_: 2tn4 A: [17249] 4-calcium form complexed with ca |
PDB Entry: 2tn4 (more details), 2 Å
SCOPe Domain Sequences for d2tn4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tn4a_ a.39.1.5 (A:) Troponin C {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tdqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiie
evdedgsgtidfeeflvmmvrqmkedakgkseeelaelfrifdrnadgyidaeelaeifr
asgehvtdeeieslmkdgdknndgridfdeflkmm
Timeline for d2tn4a_: