SCOP 1.71: Domain d2tn4__: 2tn4 -

Lineage for d2tn4__ (2tn4 -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47506] (4 PDB entries)

8. Domain d2tn4__: 2tn4 - [17249]
   4-calcium form
   complexed with ca; mutant

Details for d2tn4__

PDB Entry: 2tn4, 2 Å

PDB Description: four calcium tnc

SCOP Domain Sequences for d2tn4__:

Sequence; same for both SEQRES and ATOM records:

>d2tn4__ a.39.1.5 (-) Troponin C {Rabbit (Oryctolagus cuniculus)}
tdqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiie
evdedgsgtidfeeflvmmvrqmkedakgkseeelaelfrifdrnadgyidaeelaeifr
asgehvtdeeieslmkdgdknndgridfdeflkmm

Timeline for d2tn4__:

• d2tn4__ first appeared (with stable ids) in SCOP 1.55
  
• d2tn4__ appears in SCOP 1.69
  
• d2tn4__ is called d2tn4a_ in SCOP 1.73
  
• d2tn4__ appears in the current release, SCOPe 2.08, called d2tn4a_