![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
![]() | Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) automatically mapped to Pfam PF01395 |
![]() | Protein Odorant binding protein LUSH [101190] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries) |
![]() | Domain d3b87a_: 3b87 A: [172489] automated match to d1ooha_ complexed with act, pe8 |
PDB Entry: 3b87 (more details), 2 Å
SCOPe Domain Sequences for d3b87a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b87a_ a.39.2.1 (A:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagavnk kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq fmwp
Timeline for d3b87a_: