SCOPe 2.06: Domain d3b86a_: 3b86 A:

Lineage for d3b86a_ (3b86 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Odorant binding protein LUSH [101190] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)

8. Domain d3b86a_: 3b86 A: [172487]
   automated match to d1oofa_
   complexed with act, eoh, pg4

Details for d3b86a_

PDB Entry: 3b86, 2 Å

PDB Description: crystal structure of t57s substituted lush protein complexed with ethanol

PDB Compounds: (A:) General odorant-binding protein lush

SCOPe Domain Sequences for d3b86a_:

Sequence; same for both SEQRES and ATOM records:

>d3b86a_ a.39.2.1 (A:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagsvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

Timeline for d3b86a_:

• d3b86a_ first appeared in SCOPe 2.01
  
• d3b86a_ appears in SCOPe 2.05
  
• d3b86a_ appears in SCOPe 2.07
  
• d3b86a_ appears in the current release, SCOPe 2.08