SCOPe 2.01: Domain d3b83e_: 3b83 E:

Lineage for d3b83e_ (3b83 E:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (1 PDB entry)

8. Domain d3b83e_: 3b83 E: [172482]
   automated match to d1tena_

Details for d3b83e_

PDB Entry: 3b83, 2.4 Å

PDB Description: Computer-Based Redesign of a beta Sandwich Protein Suggests that Extensive Negative Design Is Not Required for De Novo beta Sheet Design.

PDB Compounds: (E:) ten-d3

SCOPe Domain Sequences for d3b83e_:

Sequence; same for both SEQRES and ATOM records:

>d3b83e_ b.1.2.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
nlepnttyeirivarngqqysppvsttfttgslehhhhh

Timeline for d3b83e_:

• d3b83e_ is new in SCOPe 2.01-stable
  
• d3b83e_ appears in SCOPe 2.02
  
• d3b83e_ appears in the current release, SCOPe 2.08, called d3b83e1