SCOPe 2.05: Domain d3b83a_: 3b83 A:

Lineage for d3b83a_ (3b83 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (36 PDB entries)

8. Domain d3b83a_: 3b83 A: [172478]
   automated match to d1tena_

Details for d3b83a_

PDB Entry: 3b83, 2.4 Å

PDB Description: Computer-Based Redesign of a beta Sandwich Protein Suggests that Extensive Negative Design Is Not Required for De Novo beta Sheet Design.

PDB Compounds: (A:) ten-d3

SCOPe Domain Sequences for d3b83a_:

Sequence; same for both SEQRES and ATOM records:

>d3b83a_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlqppfnikvtnitlttavvtwqppilpiegilvtfgrkndpsdettvdltssitsltlt
nlepnttyeirivarngqqysppvsttfttgsleh

Timeline for d3b83a_:

• d3b83a_ first appeared in SCOPe 2.01
  
• d3b83a_ appears in SCOPe 2.04
  
• d3b83a_ is called d3b83a1 in SCOPe 2.06
  
• d3b83a_ appears in the current release, SCOPe 2.08, called d3b83a1