SCOPe 2.03: Domain d3b82f_: 3b82 F:

Lineage for d3b82f_ (3b82 F:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Exotoxin A, C-terminal domain [56406] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [56407] (10 PDB entries)

8. Domain d3b82f_: 3b82 F: [172477]
   Other proteins in same PDB: d3b82a1, d3b82a2, d3b82a3, d3b82a4, d3b82a5, d3b82c1, d3b82c2, d3b82c3, d3b82c4, d3b82c5, d3b82e1, d3b82e2, d3b82e3, d3b82e4, d3b82e5
   automated match to d1aera_
   protein/RNA complex; complexed with nad

Details for d3b82f_

PDB Entry: 3b82, 2.35 Å

PDB Description: structure of the eef2-exoa(e546h)-nad+ complex

PDB Compounds: (F:) exotoxin a

SCOPe Domain Sequences for d3b82f_:

Sequence; same for both SEQRES and ATOM records:

>d3b82f_ d.166.1.1 (F:) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
aflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpheeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

Timeline for d3b82f_:

• d3b82f_ first appeared in SCOPe 2.01
  
• d3b82f_ appears in SCOPe 2.02
  
• d3b82f_ appears in SCOPe 2.04
  
• d3b82f_ appears in the current release, SCOPe 2.08, called d3b82f1