SCOPe 2.08: Domain d1trfa_: 1trf A:

Lineage for d1trfa_ (1trf A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [47505] (2 PDB entries)

8. Domain d1trfa_: 1trf A: [17247]
   N-terminal domain of two EF-hands
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1trfa_

PDB Entry: 1trf

PDB Description: solution structure of the tr1c fragment of skeletal muscle troponin-c

PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d1trfa_:

Sequence; same for both SEQRES and ATOM records:

>d1trfa_ a.39.1.5 (A:) Troponin C {Turkey (Meleagris gallopavo) [TaxId: 9103]}
aflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiieevdedgsg
tidfeeflvmmvrqmk

Timeline for d1trfa_:

• d1trfa_ first appeared (with stable ids) in SCOP 1.55, called d1trf__
  
• d1trfa_ appears in SCOPe 2.07