Lineage for d3b7md_ (3b7m D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780292Species Rhodothermus marinus [TaxId:29549] [188274] (1 PDB entry)
  8. 2780296Domain d3b7md_: 3b7m D: [172469]
    automated match to d1h0ba_
    mutant

Details for d3b7md_

PDB Entry: 3b7m (more details), 2.1 Å

PDB Description: crystal structure of a meso-active thermo-stable cellulase (mt cel12a) derived by making non-contiguous mutations in the active surface of the cel12a cellulase of rhodothermus marinus
PDB Compounds: (D:) cellulase

SCOPe Domain Sequences for d3b7md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b7md_ b.29.1.11 (D:) automated matches {Rhodothermus marinus [TaxId: 29549]}
stvelcgqwdtrtvaggrytvsnnvwgaetaqcievgletgnftitraehdngnnvaayp
niqfaipqprrvqelsdvrtswtltpittgrwnaaydiffaanpnhvtysgdaelmiwln
kngdvmpigsrvatvelagatwevwyadngamnvisyvrttpttsvteldlkafiddava
rgyirpewyllsvqtgfelftggaglrsadfsvtvq

SCOPe Domain Coordinates for d3b7md_:

Click to download the PDB-style file with coordinates for d3b7md_.
(The format of our PDB-style files is described here.)

Timeline for d3b7md_: