Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein automated matches [190135] (9 species) not a true protein |
Species Rhodothermus marinus [TaxId:29549] [188274] (1 PDB entry) |
Domain d3b7mb_: 3b7m B: [172467] automated match to d1h0ba_ mutant |
PDB Entry: 3b7m (more details), 2.1 Å
SCOPe Domain Sequences for d3b7mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7mb_ b.29.1.11 (B:) automated matches {Rhodothermus marinus [TaxId: 29549]} stvelcgqwdtrtvaggrytvsnnvwgaetaqcievgletgnftitraehdngnnvaayp niqfaipqprrvqelsdvrtswtltpittgrwnaaydiffaanpnhvtysgdaelmiwln kngdvmpigsrvatvelagatwevwyadngamnvisyvrttpttsvteldlkafiddava rgyirpewyllsvqtgfelftggaglrsadfsvtvq
Timeline for d3b7mb_: