SCOPe 2.05: Domain d3b7mb_: 3b7m B:

Lineage for d3b7mb_ (3b7m B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (9 species)
   not a true protein

7. Species Rhodothermus marinus [TaxId:29549] [188274] (1 PDB entry)

8. Domain d3b7mb_: 3b7m B: [172467]
   automated match to d1h0ba_
   mutant

Details for d3b7mb_

PDB Entry: 3b7m, 2.1 Å

PDB Description: crystal structure of a meso-active thermo-stable cellulase (mt cel12a) derived by making non-contiguous mutations in the active surface of the cel12a cellulase of rhodothermus marinus

PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d3b7mb_:

Sequence; same for both SEQRES and ATOM records:

>d3b7mb_ b.29.1.11 (B:) automated matches {Rhodothermus marinus [TaxId: 29549]}
stvelcgqwdtrtvaggrytvsnnvwgaetaqcievgletgnftitraehdngnnvaayp
niqfaipqprrvqelsdvrtswtltpittgrwnaaydiffaanpnhvtysgdaelmiwln
kngdvmpigsrvatvelagatwevwyadngamnvisyvrttpttsvteldlkafiddava
rgyirpewyllsvqtgfelftggaglrsadfsvtvq

Timeline for d3b7mb_:

• d3b7mb_ first appeared in SCOPe 2.01
  
• d3b7mb_ appears in SCOPe 2.04
  
• d3b7mb_ appears in SCOPe 2.06
  
• d3b7mb_ appears in the current release, SCOPe 2.08