Lineage for d3b7la_ (3b7l A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014347Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2014348Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2014349Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 2014394Protein automated matches [190489] (5 species)
    not a true protein
  7. 2014395Species Human (Homo sapiens) [TaxId:9606] [187688] (78 PDB entries)
  8. 2014401Domain d3b7la_: 3b7l A: [172465]
    automated match to d1fpsa_
    complexed with m0n, mg

Details for d3b7la_

PDB Entry: 3b7l (more details), 1.95 Å

PDB Description: human farnesyl diphosphate synthase complexed with mg and minodronate
PDB Compounds: (A:) Farnesyl pyrophosphate synthetase

SCOPe Domain Sequences for d3b7la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b7la_ a.128.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiyk

SCOPe Domain Coordinates for d3b7la_:

Click to download the PDB-style file with coordinates for d3b7la_.
(The format of our PDB-style files is described here.)

Timeline for d3b7la_: