SCOPe 2.01: Domain d3b7je_: 3b7j E:

Lineage for d3b7je_ (3b7j E:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.6: FabZ-like [110902] (1 protein)

6. Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)

7. Species Helicobacter pylori [TaxId:210] [188573] (11 PDB entries)

8. Domain d3b7je_: 3b7j E: [172463]
   automated match to d1u1za_
   complexed with ben, cl, jug

Details for d3b7je_

PDB Entry: 3b7j, 2.4 Å

PDB Description: Crystal structure of (3R)-Hydroxyacyl-Acyl Carrier Protein Dehydratase(FabZ) from Helicobacter pylori complexed with juglone

PDB Compounds: (E:) (3R)-hydroxymyristoyl-acyl carrier protein dehydratase

SCOPe Domain Sequences for d3b7je_:

Sequence; same for both SEQRES and ATOM records:

>d3b7je_ d.38.1.6 (E:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
lqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpg
vlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlk
hkgmiwqvggtaqvdgkvvaeaelkamiaere

Timeline for d3b7je_:

• d3b7je_ is new in SCOPe 2.01-stable
  
• d3b7je_ appears in SCOPe 2.02
  
• d3b7je_ appears in the current release, SCOPe 2.08