Lineage for d3b6xa_ (3b6x A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 915108Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 915109Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
  6. 915122Protein Odorant binding protein LUSH [101190] (1 species)
  7. 915123Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)
  8. 915134Domain d3b6xa_: 3b6x A: [172449]
    automated match to d1ooha_
    complexed with 1bo, act

Details for d3b6xa_

PDB Entry: 3b6x (more details), 2 Å

PDB Description: complex of s52a substituted drosophila lush protein with butanol
PDB Compounds: (A:) General odorant-binding protein lush

SCOPe Domain Sequences for d3b6xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b6xa_ a.39.2.1 (A:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
hmtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvalmagtvn
kkgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadg
qfmwp

SCOPe Domain Coordinates for d3b6xa_:

Click to download the PDB-style file with coordinates for d3b6xa_.
(The format of our PDB-style files is described here.)

Timeline for d3b6xa_: