Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (24 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [188285] (5 PDB entries) |
Domain d3b6mb_: 3b6m B: [172441] automated match to d1zwka1 complexed with 144, 15p, fmn |
PDB Entry: 3b6m (more details), 1.85 Å
SCOPe Domain Sequences for d3b6mb_:
Sequence, based on SEQRES records: (download)
>d3b6mb_ c.23.5.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi aryqgeyvaglavklng
>d3b6mb_ c.23.5.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe qtitstwttlahhgmvivpigyaaqeggtpygattiaggdgsrqpsqeelsiaryqgeyv aglavklng
Timeline for d3b6mb_: