SCOPe 2.02: Domain d3b6ma_: 3b6m A:

Lineage for d3b6ma_ (3b6m A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (5 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188285] (4 PDB entries)

8. Domain d3b6ma_: 3b6m A: [172440]
   automated match to d1zwka1
   complexed with 144, 15p, fmn

Details for d3b6ma_

PDB Entry: 3b6m, 1.85 Å

PDB Description: WrbA from Escherichia coli, second crystal form

PDB Compounds: (A:) Flavoprotein WrbA

SCOPe Domain Sequences for d3b6ma_:

Sequence, based on SEQRES records:

>d3b6ma_ c.23.5.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng

Sequence, based on observed residues (ATOM records):

>d3b6ma_ c.23.5.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqggtpygattiaggdgsrqpsqeelsiaryqgeyva
glavklng

Timeline for d3b6ma_:

• d3b6ma_ first appeared in SCOPe 2.01
  
• d3b6ma_ appears in SCOPe 2.03
  
• d3b6ma_ appears in the current release, SCOPe 2.08