Lineage for d1aj4a_ (1aj4 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2324288Protein Troponin C [47503] (6 species)
  7. 2324289Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
    Uniprot P09860
  8. 2324312Domain d1aj4a_: 1aj4 A: [17244]
    complexed with ca

Details for d1aj4a_

PDB Entry: 1aj4 (more details)

PDB Description: structure of calcium-saturated cardiac troponin c, nmr, 1 structure
PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d1aj4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aj4a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
adiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemi
devdedgsgtvdfdeflvmmvrsmkddskgkteeelsdlfrmfdknadgyidleelkiml
qatgetiteddieelmkdgdknndgridydeflefmkgve

SCOPe Domain Coordinates for d1aj4a_:

Click to download the PDB-style file with coordinates for d1aj4a_.
(The format of our PDB-style files is described here.)

Timeline for d1aj4a_: