| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
| Protein automated matches [190158] (31 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [188285] (5 PDB entries) |
| Domain d3b6ka_: 3b6k A: [172438] automated match to d1zwka1 complexed with 15p, fmn, plq |
PDB Entry: 3b6k (more details), 1.99 Å
SCOPe Domain Sequences for d3b6ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b6ka_ c.23.5.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng
Timeline for d3b6ka_: