Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (24 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [188285] (5 PDB entries) |
Domain d3b6jb_: 3b6j B: [172437] automated match to d1zwka1 complexed with 15p, amp, fmn, nad |
PDB Entry: 3b6j (more details), 2.05 Å
SCOPe Domain Sequences for d3b6jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b6jb_ c.23.5.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi aryqgeyvaglavklng
Timeline for d3b6jb_: