Lineage for d3b6jb_ (3b6j B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838906Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 1838907Protein automated matches [190158] (18 species)
    not a true protein
  7. 1838940Species Escherichia coli K-12 [TaxId:83333] [188285] (5 PDB entries)
  8. 1838946Domain d3b6jb_: 3b6j B: [172437]
    automated match to d1zwka1
    complexed with 15p, amp, fmn, nad

Details for d3b6jb_

PDB Entry: 3b6j (more details), 2.05 Å

PDB Description: WrbA from Escherichia coli, NADH complex
PDB Compounds: (B:) Flavoprotein WrbA

SCOPe Domain Sequences for d3b6jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b6jb_ c.23.5.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng

SCOPe Domain Coordinates for d3b6jb_:

Click to download the PDB-style file with coordinates for d3b6jb_.
(The format of our PDB-style files is described here.)

Timeline for d3b6jb_: