Lineage for d3b6ia_ (3b6i A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2116045Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2116046Protein automated matches [190158] (24 species)
    not a true protein
  7. 2116083Species Escherichia coli K-12 [TaxId:83333] [188285] (5 PDB entries)
  8. 2116084Domain d3b6ia_: 3b6i A: [172434]
    automated match to d1zwka1
    complexed with 15p, fmn

Details for d3b6ia_

PDB Entry: 3b6i (more details), 1.66 Å

PDB Description: WrbA from Escherichia coli, native structure
PDB Compounds: (A:) Flavoprotein WrbA

SCOPe Domain Sequences for d3b6ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b6ia_ c.23.5.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng

SCOPe Domain Coordinates for d3b6ia_:

Click to download the PDB-style file with coordinates for d3b6ia_.
(The format of our PDB-style files is described here.)

Timeline for d3b6ia_: