SCOPe 2.06: Domain d3b6ia_: 3b6i A:

Lineage for d3b6ia_ (3b6i A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (24 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188285] (5 PDB entries)

8. Domain d3b6ia_: 3b6i A: [172434]
   automated match to d1zwka1
   complexed with 15p, fmn

Details for d3b6ia_

PDB Entry: 3b6i, 1.66 Å

PDB Description: WrbA from Escherichia coli, native structure

PDB Compounds: (A:) Flavoprotein WrbA

SCOPe Domain Sequences for d3b6ia_:

Sequence; same for both SEQRES and ATOM records:

>d3b6ia_ c.23.5.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng

Timeline for d3b6ia_:

• d3b6ia_ first appeared in SCOPe 2.01
  
• d3b6ia_ appears in SCOPe 2.05
  
• d3b6ia_ appears in SCOPe 2.07
  
• d3b6ia_ appears in the current release, SCOPe 2.08