SCOPe 2.01: Domain d3b5kb_: 3b5k B:

Lineage for d3b5kb_ (3b5k B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187941] (4 PDB entries)

8. Domain d3b5kb_: 3b5k B: [172433]
   automated match to d1hula_

Details for d3b5kb_

PDB Entry: 3b5k, 2.5 Å

PDB Description: crystal structure of murine interleukin-5

PDB Compounds: (B:) Interleukin-5

SCOPe Domain Sequences for d3b5kb_:

Sequence; same for both SEQRES and ATOM records:

>d3b5kb_ a.26.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iptstvvketltqlsahralltsnetlrlpvpthknhqlcigeifqgldilknqtvrggt
verlfqnlslikkyidrqkekcgeerrrtrqfldylqeflgvlste

Timeline for d3b5kb_:

• d3b5kb_ is new in SCOPe 2.01-stable
  
• d3b5kb_ appears in SCOPe 2.02
  
• d3b5kb_ appears in the current release, SCOPe 2.08