Lineage for d3b5ka_ (3b5k A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318696Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2318697Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2318797Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2318965Protein automated matches [190501] (4 species)
    not a true protein
  7. 2319012Species Mouse (Mus musculus) [TaxId:10090] [187941] (5 PDB entries)
  8. 2319023Domain d3b5ka_: 3b5k A: [172432]
    automated match to d1hula_

Details for d3b5ka_

PDB Entry: 3b5k (more details), 2.5 Å

PDB Description: crystal structure of murine interleukin-5
PDB Compounds: (A:) Interleukin-5

SCOPe Domain Sequences for d3b5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b5ka_ a.26.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tstvvketltqlsahralltsnetlrlpvpthknhqlcigeifqgldilknqtvrggtve
rlfqnlslikkyidrqkekcgeerrrtrqfldylqeflgvlstew

SCOPe Domain Coordinates for d3b5ka_:

Click to download the PDB-style file with coordinates for d3b5ka_.
(The format of our PDB-style files is described here.)

Timeline for d3b5ka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3b5kb_