SCOPe 2.07: Domain d3b5ga_: 3b5g A:

Lineage for d3b5ga_ (3b5g A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d3b5ga_: 3b5g A: [172430]
   automated match to d1cd0a_
   complexed with act, gol, na; mutant

Details for d3b5ga_

PDB Entry: 3b5g, 1.9 Å

PDB Description: Crystal Structure of the Unstable and Highly Fibrillogenic PRO7SER Mutant of the Recombinant Variable Domain 6AJL2

PDB Compounds: (A:) amyloid lambda 6 light chain variable region pip

SCOPe Domain Sequences for d3b5ga_:

Sequence; same for both SEQRES and ATOM records:

>d3b5ga_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl

Timeline for d3b5ga_:

• d3b5ga_ first appeared in SCOPe 2.01
  
• d3b5ga_ appears in SCOPe 2.06
  
• d3b5ga_ appears in the current release, SCOPe 2.08